PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK19314.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 729aa    MW: 82908.4 Da    PI: 5.6599
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK19314.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.11.4e-5661331128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtdeelv +yLk+k++g+k++l e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk gyWkatgkd++v s +++
  PK19314.1   6 LPPGFRFHPTDEELVAYYLKRKINGRKIDL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKGGYWKATGKDRKVNS-QTR 103
                79****************************.99***************6434555777**************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +vg+kktLv+y+grap+g++tdWvmheyrl
  PK19314.1 104 AVGMKKTLVYYRGRAPHGSRTDWVMHEYRL 133
                9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-644156IPR003441NAC domain
PROSITE profilePS5100562.1416156IPR003441NAC domain
PfamPF023654.6E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 729 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIDLEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKGGYWK ATGKDRKVNS QTRAVGMKKT LVYYRGRAPH  120
GSRTDWVMHE YRLDERECEI PSGLQDAYAL CRVFKKSAVG PKIGEQYYGS TSTSTTNHMS  180
QNHHQILNHN NRNINMTSDH SSSIEIYSDG RCDDFESNNY SMLPPDTCSA PKSMMQRYRP  240
EYHHSHKWTN FLSNDDNFNY NFGTTSTSSF QNLGGISYPP SKVDVALECA RLQHRLTLPP  300
LEVEDFGQAS AKINEFKAMQ SSAHQHQAIL ETTANDTDIL QEILSVAHVS QELINQPSSI  360
FADDASMWGV SNVNIGTAAD DFSFMVGQDT QYNQSLLENN HMNSLRFVDN SWEDHLARSI  420
EIGDFDEDFK SDQRSAENLR WIGMSSKIAE ESFVEEQKIV PFENISSYRR EEHADNNGEA  480
CHQSSCNNKE LNEENEQTND QFSLEFINSD PNENLIEEGN MDEYSSSPSF EVVEEIKVNH  540
GLFVSTRQVA ETFFHQSVPS QTVQVHLNPV LLLSNHFLVG SKGTHDINFA RKSDQTLTHD  600
RDQDSFTTVI MKYNKNIVEM TKSMMVAWWT ILSTIISMIS LSWTSVEQVE KINVFGTSSS  660
TRAGVFEENE MGSDVSFFIK QRKRGVGAKL CNETGKVSVV NIRGANNLSV FLKKIGVFLT  720
ITLALCTMW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-57116215174NAC domain-containing protein 19
3swm_B1e-57116215174NAC domain-containing protein 19
3swm_C1e-57116215174NAC domain-containing protein 19
3swm_D1e-57116215174NAC domain-containing protein 19
3swp_A1e-57116215174NAC domain-containing protein 19
3swp_B1e-57116215174NAC domain-containing protein 19
3swp_C1e-57116215174NAC domain-containing protein 19
3swp_D1e-57116215174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007215001.10.0hypothetical protein PRUPE_ppa002384mg
TrEMBLM5XAW60.0M5XAW6_PRUPE; Uncharacterized protein
STRINGVIT_04s0079g00280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-165NAC domain containing protein 28